Structure of PDB 6j3z Chain j Binding Site BS01

Receptor Information

>6j3z Chain j (length=34)

RIPLWLVGLVGGLAVITMLSLFFYGSYSGLGSSL

Ligand information

>6j3z Chain f (length=28)

FRWLAIHGLAIPTVFFLGGITAMQFIQR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6j3z Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): M23 L26 F27 G30 G34 L35 L39
• Binding residue (residue number reindexed from 1): M18 L21 F22 G25 G29 L30 L34

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 01:32:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6j3z', asym_id = 'j', bs = 'BS01', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6j3z', asym_id='j', bs='BS01', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0009523,0009539,0015979,0016020', uniprot = '', pdbid = '6j3z', asym_id = 'j'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0009539,0015979,0016020', uniprot='', pdbid='6j3z', asym_id='j')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>