Structure of PDB 5nrl Chain j Binding Site BS01

Receptor Information

>5nrl Chain j (length=74) Species: 4932 (Saccharomyces cerevisiae)

MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKL
NEIYIRGTFIKFIKLQDNIIDKVK

Ligand information

>5nrl Chain 6 (length=95)

guucgcgaacuucguggacauuuggucaauuugaaacaauacagagauca
gcaguuccccugcauaaggaugaaccguucaaagagauuuguuuu

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5nrl Structure of a pre-catalytic spliceosome.
• Resolution: 7.2 Å
• Binding residue (original residue number in PDB): W35 N37 R72 T74
• Binding residue (residue number reindexed from 1): W35 N37 R56 T58

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0017070 U6 snRNA binding

Biological Process

• GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
• GO:0000387 spliceosomal snRNP assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing
• GO:0008380 RNA splicing
• GO:0033962 P-body assembly
• GO:0042149 cellular response to glucose starvation

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0005730 nucleolus
• GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
• GO:0005737 cytoplasm
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0097525 spliceosomal snRNP complex
• GO:0097526 spliceosomal tri-snRNP complex
• GO:1990726 Lsm1-7-Pat1 complex

External links

• PDB: RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
• PDBsum: 5nrl
• PubMed: 28530653
• UniProt: P40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 (Gene Name=LSM4)