Structure of PDB 5luf Chain j Binding Site BS01

Receptor Information
>5luf Chain j (length=62) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGK
LWKHIKHKYENK
Ligand information
>5luf Chain k (length=22) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RNWVPTAQLWGAVGAVGLVSAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5luf Functional asymmetry and electron flow in the bovine respirasome.
Resolution9.1 Å
Binding residue
(original residue number in PDB)		T17 S18 A21 L22 V25 L29
Binding residue
(residue number reindexed from 1)		T17 S18 A21 L22 V25 L29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045275 respiratory chain complex III

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5luf, PDBe:5luf, PDBj:5luf
PDBsum5luf
PubMed27830641
UniProtP00130|QCR9_BOVIN Cytochrome b-c1 complex subunit 9 (Gene Name=UQCR10)

[Back to BioLiP]