Structure of PDB 2ybb Chain j Binding Site BS01

Receptor Information
>2ybb Chain j (length=62) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGK
LWKHIKHKYENK
Ligand information
>2ybb Chain K (length=22) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RNWVPTAQLWGAVGAVGLVSAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ybb Arrangement of Electron Transport Chain Components in Bovine Mitochondrial Supercomplex I(1)III(2)Iv(1).
Resolution19.0 Å
Binding residue
(original residue number in PDB)		S18 V25 L29
Binding residue
(residue number reindexed from 1)		S18 V25 L29
Enzymatic activity
Enzyme Commision number 1.10.2.2: Transferred entry: 7.1.1.8.
Gene Ontology
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045275 respiratory chain complex III

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ybb, PDBe:2ybb, PDBj:2ybb
PDBsum2ybb
PubMed21909073
UniProtP00130|QCR9_BOVIN Cytochrome b-c1 complex subunit 9 (Gene Name=UQCR10)

[Back to BioLiP]