Structure of PDB 8buu Chain i Binding Site BS01

Receptor Information
>8buu Chain i (length=128) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPL
TLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAG
LLTRDARMKERKKYGLKGARRAPQFSKR
Ligand information
>8buu Chain V (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgggguggagcaguucgguagcucgucgggcucauaacccgaaggucgc
agguucaaauccugcccccgcaa
<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K129 R130
Binding residue
(residue number reindexed from 1)		K127 R128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum8buu
PubMed36951104
UniProtP21470|RS9_BACSU Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]