Structure of PDB 7r6k Chain i Binding Site BS01

Receptor Information
>7r6k Chain i (length=52) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNI
IA
Ligand information
>7r6k Chain 1 (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugaacuuaagcauaaagcggagucgaguuguuugcagcucuaagcuac
ggugaucgucgaaggggcgaaagacaagauggggaagcuccguuucaaug
uugagcuugacucuaguuguggggaguaaaguuaccacaucgugagacag
gu
<<<.....<......>.>>>......<<<<<<<..>>>>>>>.....<.<
<<...>>>.....>...<....>........<<<....>>>.......<<
<.<<<<<<..<<<<.<...>..>>>>..>>>>>.>.>>><<....>>...
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r6k Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		Y53 R76 L77 G78 R82 K86
Binding residue
(residue number reindexed from 1)		Y10 R33 L34 G35 R39 K43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6k, PDBe:7r6k, PDBj:7r6k
PDBsum7r6k
PubMed36482249
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]