Structure of PDB 7o3j Chain i Binding Site BS01

Receptor Information
>7o3j Chain i (length=131) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REANARAAVEAAFEQRVGAYYNLKYMMSGDKDIAPVNAWDDGRFTYFKFS
ANADLPSIYFVDAEGNESLVPRTTVGSSNNIIAVHKVNPKWMIRLGNRAL
AIFNEAYDPNGVPNDTGTASPAVRRVNKGGN
Ligand information
>7o3j Chain j (length=28) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CASAPKPKQPSDFNREPVNKTVPVEIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o3j Cryo-EM structure of a type IV secretion system.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y156 L158 Y160 M161 M162 S163 G164 K166 N172 A173 W174 K183 M227 R229 N232 A234 F238
Binding residue
(residue number reindexed from 1)		Y21 L23 Y25 M26 M27 S28 G29 K31 N37 A38 W39 K48 M92 R94 N97 A99 F103
Enzymatic activity
Enzyme Commision number ?
External links