Structure of PDB 6qld Chain i Binding Site BS01

Receptor Information
>6qld Chain i (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN
LL
Ligand information
>6qld Chain G (length=124) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qld Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
Resolution4.15 Å
Binding residue
(original residue number in PDB)		Q17 S18 R19 K22 R31 R79
Binding residue
(residue number reindexed from 1)		Q1 S2 R3 K6 R15 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6qld, PDBe:6qld, PDBj:6qld
PDBsum6qld
PubMed31578520
UniProtP04911|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)

[Back to BioLiP]