Structure of PDB 5o9z Chain i Binding Site BS01

Receptor Information
>5o9z Chain i (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDG
ALSGHLGEVLIRCNNVLYIRG
Ligand information
>5o9z Chain 4 (length=137) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugagguuuauccgaggcgcg
auuauugcuaauuacuuuucccaauaccccgccgugacgacuugcaauau
agucggcauuggcaauuuuugacagucucgagacugg
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>............................<<<<<<.<<<<<........
>>>>>.>>>.>>>.........<<<<<<..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o9z Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		R65 C66 N67
Binding residue
(residue number reindexed from 1)		R62 C63 N64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005683 U7 snRNP
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030532 small nuclear ribonucleoprotein complex
GO:0034709 methylosome
GO:0034715 pICln-Sm protein complex
GO:0034719 SMN-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0120114 Sm-like protein family complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o9z, PDBe:5o9z, PDBj:5o9z
PDBsum5o9z
PubMed28781166
UniProtP62306|RUXF_HUMAN Small nuclear ribonucleoprotein F (Gene Name=SNRPF)

[Back to BioLiP]