Structure of PDB 5gpn Chain i Binding Site BS01

Receptor Information
>5gpn Chain i (length=90) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPLVYMNIIMAFAIALAGLLMYRSHLMSSLLCLEGMMLSLFIMSTLIILN
THFTLANMMPIILLVFAACEAALGLSLLVMVSNTYGTDYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gpn The architecture of the mammalian respirasome.
Resolution5.4 Å
Binding residue
(original residue number in PDB)		M1 M6
Binding residue
(residue number reindexed from 1)		M1 M6
Enzymatic activity
Enzyme Commision number 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
Gene Ontology
Molecular Function
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H
Biological Process
GO:0042773 ATP synthesis coupled electron transport
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gpn, PDBe:5gpn, PDBj:5gpn
PDBsum5gpn
PubMed27654917
UniProtP56632|NU4LM_PIG NADH-ubiquinone oxidoreductase chain 4L (Gene Name=MT-ND4L)

[Back to BioLiP]