Structure of PDB 5gag Chain i Binding Site BS01

Receptor Information

>5gag Chain i (length=126) Species: 562 (Escherichia coli)

GFDLNDFLEQLRQMKNMGGPPPPPPPPPPPPPPPPPPPPPPDDKVLVRME
AIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
KKMKKGGPPPPPPPPPPPPPPPPPPP

Ligand information

>5gag Chain 1 (length=43)

ucuguuuaccaggucagguccggaaggaagcagccaaggcaga

<<<<<<<....<<<....<<<....>>>....>>>.>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gag Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): V374 A378 N381 S382 M383 T384 M385 E387 S397 R398 R401 G405 C406
• Binding residue (residue number reindexed from 1): V47 A51 N54 S55 M56 T57 M58 E60 S70 R71 R74 G78 C79

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0008312 7S RNA binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0048500 signal recognition particle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5gag, PDBe:5gag, PDBj:5gag
• PDBsum: 5gag
• PubMed: 26804923
• UniProt: P0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)