Structure of PDB 8p6i Chain h Binding Site BS01

Receptor Information
>8p6i Chain h (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGAELVKPGASVKLSCKASGYTFTNYYMYWVLQRPGQGLEWIGE
INPSNGGTTFNEKFKNKATLTVDKSSSTAYMQLNSLTSEDSAVYYCTRSR
YGNYVNYGMDYWGQGTSVTVSSASTTPPSVYPLASMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSTVTCNVAHPASSTK
VDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p6i Reverse-engineering the anti-MUC1 antibody 139H2 by mass spectrometry-based de novo sequencing.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T30 N31 Y32 Y33 E50 S54 T59 Y101 Y104
Binding residue
(residue number reindexed from 1)		T30 N31 Y32 Y33 E50 S54 T59 Y101 Y104
External links