Structure of PDB 8p2f Chain h Binding Site BS01

Receptor Information
>8p2f Chain h (length=148) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVE
QRSGRDALEVFEEAINNIMPVLEVKARRSNYQVPVEVRPERRTTLGLRWL
VNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFA
Ligand information
>8p2f Chain D (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Resolution2.44 Å
Binding residue
(original residue number in PDB)		Q86 K143
Binding residue
(residue number reindexed from 1)		Q82 K139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtP48940|RS7_STAA8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]