Structure of PDB 8iug Chain h Binding Site BS01

Receptor Information
>8iug Chain h (length=47) Species: 120962 (Roseiflexus castenholzii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPWPVWSGYALCFVPLAAVILGFIIAARFTDKQATSAYLRLDPAKAN
Ligand information
>8iug Chain Z (length=10) Species: 120962 (Roseiflexus castenholzii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAPAGAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iug New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of native and carotenoid-depleted complexes.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		Y49 L50
Binding residue
(residue number reindexed from 1)		Y38 L39
External links