Structure of PDB 8iaq Chain h Binding Site BS01

Receptor Information
>8iaq Chain h (length=138) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEI
PEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRL
KEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN
Ligand information
>8iaq Chain X (length=27) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARPEPNPVIEGDLKPAKHGTRFFFWTV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iaq Respiratory complex Membrane domain of CI, focused map of type I, Wild type mouse under thermoneutral temperature
Resolution3.4 Å
Binding residue
(original residue number in PDB)		I142 E145 R150 D165 P167 Q170
Binding residue
(residue number reindexed from 1)		I91 E94 R99 D114 P116 Q119
External links
PDB RCSB:8iaq, PDBe:8iaq, PDBj:8iaq
PDBsum8iaq
PubMed
UniProtQ9CQH3|NDUB5_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (Gene Name=Ndufb5)

[Back to BioLiP]