Structure of PDB 7ui9 Chain h Binding Site BS01

Receptor Information
>7ui9 Chain h (length=136) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSV
TSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYV
RETSGEEIEKLLQQDREITNWARTTFRNEYGKHDFK
Ligand information
>7ui9 Chain z (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSYSPTSPSYSPTSPSYSPTSPSYS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ui9 Structural basis of a transcription pre-initiation complex on a divergent promoter.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		H45 R48 R115 K117 I119 P120
Binding residue
(residue number reindexed from 1)		H16 R19 R86 K88 I90 P91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003712 transcription coregulator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0017025 TBP-class protein binding
GO:0030674 protein-macromolecule adaptor activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ui9, PDBe:7ui9, PDBj:7ui9
PDBsum7ui9
PubMed36731470
UniProtP38304|MED8_YEAST Mediator of RNA polymerase II transcription subunit 8 (Gene Name=MED8)

[Back to BioLiP]