Structure of PDB 6qdv Chain h Binding Site BS01

Receptor Information
>6qdv Chain h (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNR
EPVQLETLSIRGNNIRYFILPDSLPLDTLL
Ligand information
>6qdv Chain 5 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccgu
ggagaggaacaaccaauuuuuugag
<<<<<<<<<<<........<<<<<<<<...........>>>>>>>>...>
>>>>>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K20 N37 R61 G62 N63
Binding residue
(residue number reindexed from 1)		K20 N37 R61 G62 N63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0006396 RNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtP62314|SMD1_HUMAN Small nuclear ribonucleoprotein Sm D1 (Gene Name=SNRPD1)

[Back to BioLiP]