Structure of PDB 6kva Chain h Binding Site BS01

Receptor Information
>6kva Chain h (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGSSVKVSCKASGGTLSSYAISWVRQAPGQGPEWMGW
INPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRPDDTAVYYCASGY
CSRTRCYDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kva Selection of a picomolar antibody that targets CXCR2-mediated neutrophil activation and alleviates EAE symptoms.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y33 A34 S36 W51 N53 A98 G100 Y101 C102 W111
Binding residue
(residue number reindexed from 1)		Y32 A33 S35 W50 N52 A97 G99 Y100 C101 W110
External links