BioLiP

Receptor Information

>5osg Chain h (length=173) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NGVYVKNWGTGSVADATNVFSAAGKVVKVQLRRQRYALVFFENSAAVKKA
IDLFNEKEVLGQTVLVVPAKASPKPDAHENSSCVFVSPIFRPSTTKAQVM
ELFAGVKVQRLRMYRQNFAYAYLDSPAAAKKFVEEKNGTAFRGHTLRVAL
SARSLEKLRARQEVANVVIAAHR

>5osg Chain 2 (length=88) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uucuccagugagacgaaaaccaaugccuucacuggcaguaacacccagcu
uccugaacgcaugucaugcaugccagguuuuguugguu

.<<<<....>>>>....<<<<<<<.<<......>>...............
.........<<<.......>>>.........>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5osg The cryo-EM Structure of a Novel 40S Kinetoplastid-Specific Ribosomal Protein.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	N55 Y58 R87 F94 S98 A100 V101 K102 I105 P122 A123 K124 D130 F139 R145 P146 S147 T149 K150 Q152 R164 R166 M167 Y168 R169 Q170 N171 F172 R196 H198 R201 S205 A206 R207 K211 L212 R215 Q216 V222 I223
Binding residue (residue number reindexed from 1)	N1 Y4 R33 F40 S44 A46 V47 K48 I51 P68 A69 K70 D76 F85 R91 P92 S93 T95 K96 Q98 R110 R112 M113 Y114 R115 Q116 N117 F118 R142 H144 R147 S151 A152 R153 K157 L158 R161 Q162 V168 I169

Enzyme Commision number

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm

PDB	RCSB:5osg, PDBe:5osg, PDBj:5osg
PDBsum	5osg
PubMed	29107485
UniProt	A0A3Q8IT45

[Back to BioLiP]

Structure of PDB 5osg Chain h Binding Site BS01