Structure of PDB 5o9z Chain h Binding Site BS01

Receptor Information
>5o9z Chain h (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWT
NKDRYISKMFLRGDSVIVVLRNPL
Ligand information
>5o9z Chain 4 (length=137) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugagguuuauccgaggcgcg
auuauugcuaauuacuuuucccaauaccccgccgugacgacuugcaauau
agucggcauuggcaauuuuugacagucucgagacugg
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>............................<<<<<<.<<<<<........
>>>>>.>>>.>>>.........<<<<<<..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o9z Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
Resolution4.5 Å
Binding residue
(original residue number in PDB)
R61 H62 C63 G103 D104 S105 V106
Binding residue
(residue number reindexed from 1)
R36 H37 C38 G63 D64 S65 V66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030532 small nuclear ribonucleoprotein complex
GO:0034709 methylosome
GO:0034715 pICln-Sm protein complex
GO:0034719 SMN-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0070062 extracellular exosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5o9z, PDBe:5o9z, PDBj:5o9z
PDBsum5o9z
PubMed28781166
UniProtP62316|SMD2_HUMAN Small nuclear ribonucleoprotein Sm D2 (Gene Name=SNRPD2)

[Back to BioLiP]