Structure of PDB 3jd5 Chain h Binding Site BS01

Receptor Information
>3jd5 Chain h (length=103) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLEGFP
KQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKQDILKESGI
NFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
Resolution7.0 Å
Binding residue
(original residue number in PDB)		F324 R339
Binding residue
(residue number reindexed from 1)		F41 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3jd5, PDBe:3jd5, PDBj:3jd5
PDBsum3jd5
PubMed24799711
UniProtP82925|RT31_BOVIN Small ribosomal subunit protein mS31 (Gene Name=MRPS31)

[Back to BioLiP]