Structure of PDB 3jb9 Chain h Binding Site BS01

Receptor Information
>3jb9 Chain h (length=90) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSSRALPAHLKLKYRQESQGTEEEVRKQDLREALLRAEAAHFATQEHRRW
DEDVVFRNTHKGVDDTPRPGFVNDMLRSEFHKKFLARFVD
Ligand information
>3jb9 Chain C (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgucaaagcacuuugcaaaagcuaacguaucuguuucuugccuuuuacca
gaaacagccguuuguaaggugugcuaauuugacuguauaguuuuuguaau
cuuuu
.<<<<<<<<<<<<<<<<<<...........<<<<<<<<.<.......>.>
>>>>>>>...>>>>>>>>>>>>.....>>>>>>.................
.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
Resolution3.6 Å
Binding residue
(original residue number in PDB)		S26 R27 P30 A31 H32 L33
Binding residue
(residue number reindexed from 1)		S3 R4 P7 A8 H9 L10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum3jb9
PubMed26292707
UniProtP78794|CWC15_SCHPO Pre-mRNA-splicing factor cwf15 (Gene Name=cwf15)

[Back to BioLiP]