Structure of PDB 8urx Chain g Binding Site BS01

Receptor Information

>8urx Chain g (length=66) Species: 562 (Escherichia coli)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNI

Ligand information

>8urx Chain d (length=120)

ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggcau

<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>...
....>>...>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8urx Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
• Resolution: 6.6 Å
• Binding residue (original residue number in PDB): M1 K2 H6
• Binding residue (residue number reindexed from 1): M1 K2 H6

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:1904689 negative regulation of cytoplasmic translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8urx, PDBe:8urx, PDBj:8urx
• PDBsum: 8urx
• PubMed: 39117885
• UniProt: P0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)