Structure of PDB 8beh Chain g Binding Site BS01

Receptor Information
>8beh Chain g (length=79) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRWATPGHEERPKGYFMNRTPPAPGQSRKWEDWELPCYITSFLTIVILGV
GLNAKPDLSIETWAHQKALERLEMEKLAT
Ligand information
>8beh Chain i (length=15) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFIMEFAENLVLRLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8beh Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		V79 N82 A83 K84 P85
Binding residue
(residue number reindexed from 1)		V50 N53 A54 K55 P56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:8beh, PDBe:8beh, PDBj:8beh
PDBsum8beh
PubMed36585502
UniProtQ9SLC8

[Back to BioLiP]