Structure of PDB 7aqw Chain g Binding Site BS01

Receptor Information
>7aqw Chain g (length=75) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RWATPGHEERPKGYFMNRTPPAPGQSRKWEDWELPCYITSFLTIVILGVG
LNAKPDLSIETWAHQKALERLEMEK
Ligand information
>7aqw Chain i (length=15) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFIMEFAENLVLRLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aqw A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		V79 A83 K84 P85
Binding residue
(residue number reindexed from 1)		V49 A53 K54 P55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:7aqw, PDBe:7aqw, PDBj:7aqw
PDBsum7aqw
PubMed33768254
UniProtQ9SLC8

[Back to BioLiP]