Structure of PDB 5gm6 Chain g Binding Site BS01

Receptor Information
>5gm6 Chain g (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRH
CNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Ligand information
>5gm6 Chain D (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaggucaacaucaagaacugugggccuuugccuauagaacuuauaacga
acaugguucuugccuuuuaccagaaccauccggguguugucuccauccau
auuuuuuggaacuuuuc
<<<<<.<<<<<<<.....<<<<<<<<....>>>>>>>>............
..<<<<<<<<...........>>>>>>>>...>>>>>>>>>>>>......
.................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R15 L18 R49 R63 H64 K79 G81 R97 D99
Binding residue
(residue number reindexed from 1)		R1 L4 R35 R49 H50 K65 G67 R83 D85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0008380 RNA splicing
Cellular Component
GO:0030532 small nuclear ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtQ06217|SMD2_YEAST Small nuclear ribonucleoprotein Sm D2 (Gene Name=SMD2)

[Back to BioLiP]