Structure of PDB 5gam Chain g Binding Site BS01

Receptor Information
>5gam Chain g (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQL
GLQTVIRGNSIISLEALDA
Ligand information
>5gam Chain U (length=141) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagcuuuacagaucaauggcggagggaggucaacaucaagaacugugggc
gccuauagaacuuauaacgaacaugguucuugccuuuuaccagaaccauc
cggguguugucuccauagaaacagguaaagcuguauuuuuu
<<<<<<<<<.......<.......<<<<<.<<<<<<<<<<..<<<<<<<.
.>>>>>>>..>>>.........<<<<<<<<...........>>>>>>>>.
..>>>>>>>>>>>>......>...>>>>>>>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gam Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
Resolution3.7 Å
Binding residue
(original residue number in PDB)		I34 F35 N37 R64 G65 N66
Binding residue
(residue number reindexed from 1)		I33 F34 N36 R57 G58 N59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008150 biological_process
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0034719 SMN-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gam, PDBe:5gam, PDBj:5gam
PDBsum5gam
PubMed26829225
UniProtP40204|RUXG_YEAST Small nuclear ribonucleoprotein G (Gene Name=SMX2)

[Back to BioLiP]