Structure of PDB 4ne1 Chain g Binding Site BS01

Receptor Information
>4ne1 Chain g (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAK
DLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQ
KKKKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ne1 The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
Resolution6.499 Å
Binding residue
(original residue number in PDB)
R110 K114 K115 K117
Binding residue
(residue number reindexed from 1)
R97 K101 K102 K104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0071821 FANCM-MHF complex

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4ne1, PDBe:4ne1, PDBj:4ne1
PDBsum4ne1
PubMed24390579
UniProtQ8N2Z9|CENPS_HUMAN Centromere protein S (Gene Name=CENPS)

[Back to BioLiP]