Structure of PDB 3jb9 Chain g Binding Site BS01

Receptor Information
>3jb9 Chain g (length=148) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENSQSPNIQPLLHTENLAPAVVDNVKDDLIVSKGGNSRELARNVPVNEMV
QPALGPANPFVTKEQDSIKNSITGYAEREYVPNFVFNQEYYANTHAIYGK
RNFDDNEATTSTDLKRKSQKIKERREDPGDPSILEGDGAYKGPWAGYG
Ligand information
>3jb9 Chain N (length=90) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaucuucggaucacuuuggucaaauugaaacgauacagagaagauuagca
uggccccugcacaaggaugacacugcgacauugagagaaa
<<<<....>>>>......................................
<<...<<<.....>>>....>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y104 T125 K135
Binding residue
(residue number reindexed from 1)		Y91 T112 K122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum3jb9
PubMed26292707
UniProtO43071|PRP17_SCHPO Pre-mRNA-processing factor 17 (Gene Name=prp17)

[Back to BioLiP]