Structure of PDB 8fxr Chain f Binding Site BS01

Receptor Information
>8fxr Chain f (length=34) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKLNCRPLCQAPTASRLVSPPCFICRGVAPSAP
Ligand information
>8fxr Chain f2 (length=20) Species: 2557550 (Agrobacterium phage Milano) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAPSRLVQPGCFICRGVAVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fxr Neck and capsid architecture of the robust Agrobacterium phage Milano.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		C26 R27 G28 V29 A30 P31 S32
Binding residue
(residue number reindexed from 1)		C26 R27 G28 V29 A30 P31 S32
External links