Structure of PDB 8bz1 Chain f Binding Site BS01

Receptor Information
>8bz1 Chain f (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAV
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8bz1 Chain N (length=198) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaggggggctataaaagggggtgggggcgcgttcgtcctcactctcttc
cgatcgagaatcccggtgccgaggccgctcaattggtcgtagacagctct
agcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaa
ggggattactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bz1 Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R36 R46 I47 S48 G49 R79 K80 T81
Binding residue
(residue number reindexed from 1)		R15 R25 I26 S27 G28 R58 K59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bz1, PDBe:8bz1, PDBj:8bz1
PDBsum8bz1
PubMed37148879
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]