Structure of PDB 8bpx Chain f Binding Site BS01

Receptor Information
>8bpx Chain f (length=101) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNTDITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYL
SGIKPGIKGPSMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASYQK
R
Ligand information
>8bpx Chain v (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KVSEDKNRNYAVVAGVVAIVGSIGWYLKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bpx Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		T31 L32 L35 R36 T39 V45 T46 Y49 K58 M62
Binding residue
(residue number reindexed from 1)		T31 L32 L35 R36 T39 V45 T46 Y49 K58 M62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009853 photorespiration
Cellular Component
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bpx, PDBe:8bpx, PDBj:8bpx
PDBsum8bpx
PubMed36585502
UniProtQ84W12

[Back to BioLiP]