Structure of PDB 7lx0 Chain f Binding Site BS01

Receptor Information
>7lx0 Chain f (length=135) Species: 98439 (Fischerella thermalis PCC 7521) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTTLVPCYKSPAFVERMKNAPDSYYTTKPLKAYSQLLCGEDGLPRIALDR
LSLAVDVAIPIAIFLYTAGFIGWSGRSYLQAIKKQDKAEEKEVFIDVPLF
ISCMVMALFWPMAVIKELLAGELVAKDEEIPISVR
Ligand information
>7lx0 Chain x (length=29) Species: 98439 (Fischerella thermalis PCC 7521) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPYTFRTAWALLLLAINFIVAAYYFHIIE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lx0 Quantitative assessment of chlorophyll types in cryo-EM maps of photosystem I acclimated to far-red light
Resolution2.96 Å
Binding residue
(original residue number in PDB)		L72 D73 R74
Binding residue
(residue number reindexed from 1)		L48 D49 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lx0, PDBe:7lx0, PDBj:7lx0
PDBsum7lx0
PubMed
UniProtG6FMD3

[Back to BioLiP]