Structure of PDB 7e80 Chain f Binding Site BS01

Receptor Information
>7e80 Chain f (length=128) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQV
DAAATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVN
TMSASRSYQANIEVLNTVKSMMLKTLTL
Ligand information
>7e80 Chain 1 (length=15) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e80 Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.67 Å
Binding residue
(original residue number in PDB)
V48 F49 N104
Binding residue
(residue number reindexed from 1)
V47 F48 N100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0071978 bacterial-type flagellum-dependent swarming motility
Cellular Component
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body
GO:0030694 bacterial-type flagellum basal body, rod

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7e80, PDBe:7e80, PDBj:7e80
PDBsum7e80
PubMed33882274
UniProtP0A1I7|FLGC_SALTY Flagellar basal-body rod protein FlgC (Gene Name=flgC)

[Back to BioLiP]