Structure of PDB 7dk7 Chain f Binding Site BS01

Receptor Information
>7dk7 Chain f (length=119) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFLHWYQQKPGQPPKL
LIYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPF
TFGSGTKLEIKRADAAPTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dk7 Development and structural basis of a two-MAb cocktail for treating SARS-CoV-2 infections.
Resolution9.7 Å
Binding residue
(original residue number in PDB)		H38 Y40 Q42 P47 P48 L50 N95 F100
Binding residue
(residue number reindexed from 1)		H38 Y40 Q42 P47 P48 L50 N95 F100
External links