Structure of PDB 6trc Chain f Binding Site BS01

Receptor Information
>6trc Chain f (length=141) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPH
LVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEII
IDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
Ligand information
>6trc Chain x (length=27) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YAFRTFWAVLLLAINFLVAAYYFGILK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6trc Current limits of structural biology: The transient interaction between cytochrome c6 and photosystem I
Resolution2.98 Å
Binding residue
(original residue number in PDB)		D54 R56
Binding residue
(residue number reindexed from 1)		D54 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6trc, PDBe:6trc, PDBj:6trc
PDBsum6trc
PubMed
UniProtP0A401|PSAF_THEVB Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]