Structure of PDB 6j54 Chain f Binding Site BS01

Receptor Information
>6j54 Chain f (length=87) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASVVPLKDRRLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVN
VKKGSVAGLSMVLAAYVVFNYCRSYKELKHERLRKYH
Ligand information
>6j54 Chain d (length=24) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PFDQMTIEDLNEVFPETKLDKKKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j54 Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1.
Resolution3.94 Å
Binding residue
(original residue number in PDB)		S21 W22 I23
Binding residue
(residue number reindexed from 1)		S21 W22 I23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j54, PDBe:6j54, PDBj:6j54
PDBsum6j54
PubMed31197009
UniProtQ95339|ATPK_PIG ATP synthase subunit f, mitochondrial (Gene Name=ATP5MF)

[Back to BioLiP]