Structure of PDB 5tzs Chain f Binding Site BS01

Receptor Information
>5tzs Chain f (length=114) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIE
ILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKT
QIYAVKDKIETLLI
Ligand information
>5tzs Chain 2 (length=126) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuccacugaauccaacuugguugaugagu
uaaccuuuguacccgugagaaaccguauggccgaugaucuuacccauggg
uggguacaaauggcagucugacaagu
....................................<<<<..........
...<.<<<<<<<<.<.......<<<..>>>........>..<<<<..>>>
>.>>>>>>>>..>........>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tzs Architecture of the yeast small subunit processome.
Resolution5.1 Å
Binding residue
(original residue number in PDB)		K35 G36 E39 E59
Binding residue
(residue number reindexed from 1)		K23 G24 E27 E47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000452 snoRNA guided rRNA 2'-O-methylation
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tzs, PDBe:5tzs, PDBj:5tzs
PDBsum5tzs
PubMed27980088
UniProtP39990|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein (Gene Name=SNU13)

[Back to BioLiP]