Structure of PDB 8xr6 Chain e Binding Site BS01

Receptor Information
>8xr6 Chain e (length=75) Species: 173977 (Chroomonas placoidea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPFSDIITSIRYWIIHSITIPALYVAGWLFVSTGLAYDIFGTPRPNEYFT
QDRQQVPLVNDRFSAKQELEDLTKG
Ligand information
>8xr6 Chain f (length=29) Species: 173977 (Chroomonas placoidea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TFRWLAIHGLAVPTVFFLGAITSMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xr6 Cryo-EM structure of cryptophyte photosystem II
Resolution2.53 Å
Binding residue
(original residue number in PDB)		L31 Y32 G35 W36 F38 V39
Binding residue
(residue number reindexed from 1)		L23 Y24 G27 W28 F30 V31
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xr6, PDBe:8xr6, PDBj:8xr6
PDBsum8xr6
PubMed
UniProtA0A222AI74

[Back to BioLiP]