Structure of PDB 8ow1 Chain e Binding Site BS01

Receptor Information
>8ow1 Chain e (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMA
IMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI
Ligand information
>8ow1 Chain D (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ataagtcacatggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaatattagtgta
tttgatttccgaaagttaaaaaagaaatagtaagaaatatatatttcatt
gaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ow1 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		P134 I156
Binding residue
(residue number reindexed from 1)		P2 I24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019237 centromeric DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000278 mitotic cell cycle
GO:0009303 rRNA transcription
GO:0030543 2-micrometer plasmid partitioning
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005729 2-micrometer circle DNA
GO:0005777 peroxisome
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ow1, PDBe:8ow1, PDBj:8ow1
PDBsum8ow1
PubMed37506202
UniProtP36012|CENPA_YEAST Histone H3-like centromeric protein CSE4 (Gene Name=CSE4)

[Back to BioLiP]