Structure of PDB 8ow0 Chain e Binding Site BS01

Receptor Information
>8ow0 Chain e (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMA
IMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI
Ligand information
>8ow0 Chain D (length=121) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ataagtcacatggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaatattagtgta
tttgatttccgaaagttaaaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ow0 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
P134 S154 K155 I156 P157 R160 R177 T212
Binding residue
(residue number reindexed from 1)
P2 S22 K23 I24 P25 R28 R45 T80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019237 centromeric DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000278 mitotic cell cycle
GO:0009303 rRNA transcription
GO:0030543 2-micrometer plasmid partitioning
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005729 2-micrometer circle DNA
GO:0005777 peroxisome
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ow0, PDBe:8ow0, PDBj:8ow0
PDBsum8ow0
PubMed37506202
UniProtP36012|CENPA_YEAST Histone H3-like centromeric protein CSE4 (Gene Name=CSE4)

[Back to BioLiP]