Structure of PDB 8ibf Chain e Binding Site BS01

Receptor Information
>8ibf Chain e (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTR
AKKECKIEFDDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPPHHSGR
EEPRP
Ligand information
>8ibf Chain X (length=27) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARPEPNPVIEGDLKPAKHGTRFFFWTV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ibf Respiratory complex Membrane domain of CI, focus-refined of type II, Wild type mouse under cold temperature
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E39 C43 I47 R51 E55
Binding residue
(residue number reindexed from 1)		E38 C42 I46 R50 E54
External links
PDB RCSB:8ibf, PDBe:8ibf, PDBj:8ibf
PDBsum8ibf
PubMed
UniProtQ99LY9|NDUS5_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (Gene Name=Ndufs5)

[Back to BioLiP]