Structure of PDB 8c29 Chain e Binding Site BS01

Receptor Information
>8c29 Chain e (length=65) Species: 3329 (Picea abies) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTG
RFDSLEQLDEFTRSF
Ligand information
>8c29 Chain u (length=27) Species: 3329 (Picea abies) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKRGTPEAKKLYARVCVTMPTASVCHN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c29 Cryo-EM structure of a plant photosystem II supercomplex with light-harvesting protein Lhcb8 and alpha-tocopherol.
Resolution2.785 Å
Binding residue
(original residue number in PDB)		T67 G68 R69 D71
Binding residue
(residue number reindexed from 1)		T49 G50 R51 D53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c29, PDBe:8c29, PDBj:8c29
PDBsum8c29
PubMed37550369
UniProtR4ZGW6

[Back to BioLiP]