Structure of PDB 7rf2 Chain e Binding Site BS01

Receptor Information
>7rf2 Chain e (length=82) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRP
DSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Ligand information
>7rf2 Chain r (length=28) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DWRVLVVLLPVLLAAGWAVRNILPYAVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rf2 Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition.
Resolution2.08 Å
Binding residue
(original residue number in PDB)
R18 V21 I22 I25 T26 A29 A33 L36 F37 T40 L42 D45
Binding residue
(residue number reindexed from 1)
R16 V19 I20 I23 T24 A27 A31 L34 F35 T38 L40 D43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7rf2, PDBe:7rf2, PDBj:7rf2
PDBsum7rf2
PubMed34764256
UniProtQ8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]