Structure of PDB 7pkq Chain e Binding Site BS01

Receptor Information
>7pkq Chain e (length=176) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLPPLPRELREALYGHRWDRVIVDVRRTHTPVRGRGKREEYTAMVATGNM
RGVFGLGIGVAESAQLATARAHLDSLSRLAAVPLYRGHTLYTHVDHTFHR
LSIRMMPRPAGWGLRCPDLLYELCGLVGLRDVSIRVRGQRGSRFFVAQCF
QEALQKQTTPHDGVEATGMYIREVFR
Ligand information
>7pkq Chain 1 (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaauuagaguuuggugcuggcucagcuuucaugcgccgagcggugguuua
uacacaugcgagcuuaaggccacgagugcguaauacgcgaguu
......<<<<.........>>>>...........................
...........<<<...>>>.......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pkq The Chlamydomonas mitochondrial ribosome: how to build a ribosome from RNA fragments
Resolution4.2 Å
Binding residue
(original residue number in PDB)		R200 T202 H203 K211 H273 R274 M280 R282 W286 R289 C290 P291 S307 I308 R309 V310 Q313 R314 R317 F319
Binding residue
(residue number reindexed from 1)		R26 T28 H29 K37 H99 R100 M106 R108 W112 R115 C116 P117 S133 I134 R135 V136 Q139 R140 R143 F145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pkq, PDBe:7pkq, PDBj:7pkq
PDBsum7pkq
PubMed
UniProtA0A2K3DFB5

[Back to BioLiP]