Structure of PDB 7on1 Chain e Binding Site BS01

Receptor Information
>7on1 Chain e (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMA
IMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI
Ligand information
>7on1 Chain C (length=21) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRKSTRVKVAPLQYWRNEKIV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7on1 Cenp-A nucleosome in complex with Cenp-C
Resolution3.35 Å
Binding residue
(original residue number in PDB)		Q219 R222 R223 Q227 I229
Binding residue
(residue number reindexed from 1)		Q87 R90 R91 Q95 I97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019237 centromeric DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000278 mitotic cell cycle
GO:0009303 rRNA transcription
GO:0030543 2-micrometer plasmid partitioning
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005729 2-micrometer circle DNA
GO:0005777 peroxisome
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7on1, PDBe:7on1, PDBj:7on1
PDBsum7on1
PubMed
UniProtP36012|CENPA_YEAST Histone H3-like centromeric protein CSE4 (Gene Name=CSE4)

[Back to BioLiP]