Structure of PDB 7of3 Chain e Binding Site BS01

Receptor Information
>7of3 Chain e (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPWRLLGALCLQRPPVVSKPLTPLQEEMASLLQQIEIERSLYLAQDLEDM
WEQKFLQFKLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQDVWIL
PQAEWQPGETLRGTAERTLATLSENNMEAKFLGNAPCGHYTFKFLGAKVF
FFKALLLTGDFSQAGNKGHHVWVTKDELGDYLKPKYLAQVRRFVSDL
Ligand information
>7of3 Chain m (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLYPVLLVKQDGSTIHIRYREPRRMLAMP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7of3 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Q75 I79 W124 F128
Binding residue
(residue number reindexed from 1)		Q33 I37 W51 F55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0008150 biological_process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0030054 cell junction
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7of3, PDBe:7of3, PDBj:7of3
PDBsum7of3
PubMed34135319
UniProtQ9H2W6|RM46_HUMAN Large ribosomal subunit protein mL46 (Gene Name=MRPL46)

[Back to BioLiP]