Structure of PDB 7kwg Chain e Binding Site BS01

Receptor Information
>7kwg Chain e (length=165) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTG
KAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAP
GTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAE
DVAKLRGKTVEELYN
Ligand information
>7kwg Chain A (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acauacaggggguauuaauuugaaaaagaaaa
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kwg Stabilization of Ribosomal RNA of the Small Subunit by Spermidine in Staphylococcus aureus .
Resolution3.75 Å
Binding residue
(original residue number in PDB)		I18 R20 F31
Binding residue
(residue number reindexed from 1)		I17 R19 F30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kwg, PDBe:7kwg, PDBj:7kwg
PDBsum7kwg
PubMed34869582
UniProtQ2FW23|RS5_STAA8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]