Structure of PDB 7e80 Chain e Binding Site BS01

Receptor Information
>7e80 Chain e (length=249) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSL
ATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTR
NGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDP
PNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRI
MSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSM
Ligand information
>7e80 Chain 4 (length=15) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e80 Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.67 Å
Binding residue
(original residue number in PDB)		Y6 M9 L56 T58
Binding residue
(residue number reindexed from 1)		Y5 M8 L55 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0071978 bacterial-type flagellum-dependent swarming motility
Cellular Component
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e80, PDBe:7e80, PDBj:7e80
PDBsum7e80
PubMed33882274
UniProtP16323|FLGF_SALTY Flagellar basal-body rod protein FlgF (Gene Name=flgF)

[Back to BioLiP]