Structure of PDB 7czl Chain e Binding Site BS01

Receptor Information
>7czl Chain e (length=65) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDR
FEAKQQVETFLEQLK
Ligand information
>7czl Chain f (length=28) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVRWVAVHTLAVPTIFFLGAIAAMQFIQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7czl Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus .
Resolution3.78 Å
Binding residue
(original residue number in PDB)		F5031 G5034 W5035 F5037 V5038
Binding residue
(residue number reindexed from 1)		F12 G15 W16 F18 V19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7czl, PDBe:7czl, PDBj:7czl
PDBsum7czl
PubMed33495333
UniProtP12238|PSBE_THEVL Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]